Small ribosomal subunit protein uS2 structure
P08865
RSSA_HUMAN
RPSA

Small ribosomal subunit protein uS2

Homo sapiensTaxon: 9606

3D-structureAcetylationCell membraneCytoplasmDirect protein sequencingDisease variantHost cell receptor for virus entryHost-virus interactionIsopeptide bondMembraneNucleusPhosphoprotein+7
서열 길이

295

아미노산

분자량

32.9 kDa

이론값

실험 구조

50

PDB 항목

관련 질환

1

기록됨

기능 설명

Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA (Microbial infection) Acts as a receptor for the Adeno-associated viruses 2,3,8 and 9 (Microbial infection) Acts as a receptor for the Dengue virus (Microbial infection) Acts as a receptor for the Sindbis virus (Microbial infection) Acts as a receptor for the Venezuelan equine encephalitis virus (Microbial infection) Acts as a receptor for the pathogenic prion protein (Microbial infection) Acts as a receptor for bacteria

관련 질환

Asplenia, isolated congenital

A rare primary immunodeficiency and life-threatening condition, often presenting with pneumococcal sepsis. Most affected individuals die of severe bacterial infections in early childhood. Isolated asplenia is distinct from asplenia associated with other complex visceral defects, notably heterotaxy syndromes such as Ivemark syndrome.

아미노산 서열

MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLL
AARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPR
LLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAR
EVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTA

FASTA 형식 · 295 아미노산 · 분자량 32.9 kDa

실험 구조

50 PDB 항목
3BCH4UG04V5Z4V6X5A2Q5AJ05FLX5LKS5OA35T2C5VYC6FEC6G186G4S6G516G536G5H6G5I6IP56IP66IP86OLE6OLF6OLG6OLI6OLZ6OM06OM76QZP6XA16Y0G6Y2L6Y576YBD6YBW6Z6L6Z6M6Z6N6ZLW6ZM76ZME6ZMI6ZMO6ZMT6ZMW6ZN56ZOJ6ZOK6ZON6ZP4

번역 후 수식

  • Acylated. Acylation may be a prerequisite for conversion of the monomeric 37 kDa laminin receptor precursor (37LRP) to the mature dimeric 67 kDa laminin receptor (67LR), and may provide a mechanism for membrane association (PubMed:9581863)
  • Cleaved by stromelysin-3 (ST3) at the cell surface. Cleavage by stromelysin-3 may be a mechanism to alter cell-extracellular matrix interactions