Coagulation factor VII structure
P08709
FA7_HUMAN
F7

Coagulation factor VII

Homo sapiensTaxon: 9606

3D-structureAlternative splicingBlood coagulationCalciumCleavage on pair of basic residuesDirect protein sequencingDisease variantDisulfide bondEGF-like domainGamma-carboxyglutamic acidGlycoproteinHemostasis+11
Longueur de Séquence

466

acides aminés

Poids Moléculaire

51.6 kDa

théorique

Structures Expérimentales

50

entrées PDB

Maladies Associées

1

enregistrées

Fonction

Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa also converts factor IX to factor IXa in the presence of tissue factor and calcium (PubMed:271951)

Localisation & Distribution

Spécificité Tissulaire

Plasma

Maladies Associées

Factor VII deficiency

A hemorrhagic disease with variable presentation. The clinical picture can be very severe, with the early occurrence of intracerebral hemorrhages or repeated hemarthroses, or, in contrast, moderate with cutaneous-mucosal hemorrhages (epistaxis, menorrhagia) or hemorrhages provoked by a surgical intervention. Finally, numerous subjects are completely asymptomatic despite very low factor VII levels.

Séquence d'Acides Aminés

MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRR
ANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGS
CKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSL
LADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGG

Format FASTA · 466 acides aminés · masse 51.6 kDa

Structures Expérimentales

50 entrées PDB
1BF91CVW1DAN1DVA1F7E1F7M1FAK1FF71FFM1J9C1JBU1KLI1KLJ1O5D1QFK1W0Y1W2K1W7X1W8B1WQV1WSS1WTG1WUN1WV71YGC1Z6J2A2Q2AEI2AER2B7D2B8O2BZ62C4F2EC92F9B2FIR2FLB2FLR2PUQ2ZP02ZWL2ZZU3ELA3TH23TH33TH44IBL4ISH4ISI4JYU

Modifications Post-Traductionnelles

  • The vitamin K-dependent, enzymatic carboxylation of some glutamate residues allows the modified protein to bind calcium
  • The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains
  • O- and N-glycosylated. N-glycosylation at Asn-205 occurs cotranslationally and is mediated by STT3A-containing complexes, while glycosylation at Asn-382 is post-translational and is mediated STT3B-containing complexes before folding. O-fucosylated by POFUT1 on a conserved serine or threonine residue found in the consensus sequence C2-X(4,5)-[S/T]-C3 of EGF domains, where C2 and C3 are the second and third conserved cysteines
  • Can be either O-glucosylated or O-xylosylated at Ser-112 by POGLUT1 in vitro