Heme oxygenase 1

Homo sapiensTaxon: 9606

3D-structureApoptosisEndoplasmic reticulumHemeHost-virus interactionIronMembraneMetal-bindingOxidoreductasePhosphoproteinProteomics identificationReference proteome+2

Longueur de Séquence

288

acides aminés

Poids Moléculaire

32.8 kDa

théorique

Structures Expérimentales

entrées PDB

Maladies Associées

enregistrées

Fonction

Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron (PubMed:11121422, PubMed:19556236, PubMed:7703255). Affords protection against programmed cell death and this cytoprotective effect relies on its ability to catabolize free heme and prevent it from sensitizing cells to undergo apoptosis (PubMed:20055707) (Microbial infection) During SARS-COV-2 infection, promotes SARS-CoV-2 ORF3A-mediated autophagy but is unlikely to be required for ORF3A-mediated induction of reticulophagy Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron

Localisation & Distribution

Spécificité Tissulaire

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level)

Maladies Associées

Heme oxygenase 1 deficiency

A disease characterized by impaired stress hematopoiesis, resulting in marked erythrocyte fragmentation and intravascular hemolysis, coagulation abnormalities, endothelial damage, and iron deposition in renal and hepatic tissues. Clinical features include persistent hemolytic anemia, asplenia, nephritis, generalized erythematous rash, growth retardation and hepatomegaly.

Séquence d'Acides Aminés

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA

Format FASTA · 288 acides aminés · masse 32.8 kDa

Structures Expérimentales

26 entrées PDB

1N3U1N451NI61OYK1OYL1OZE1OZL1OZR1OZW1S131S8C1T5P1TWN1TWR1XJZ1XK01XK11XK21XK33CZY3HOK3K4F3TGM4WD45BTQ6EHA

Modifications Post-Traductionnelles

•A soluble form arises by proteolytic removal of the membrane anchor