Plasminogen activator inhibitor 1

Homo sapiensTaxon: 9606

3D-structureAlternative splicingDirect protein sequencingGlycoproteinProtease inhibitorProteomics identificationReference proteomeSecretedSerine protease inhibitorSignal

Sequence Length

402

amino acids

Molecular Weight

45.1 kDa

theoretical

Experimental Structures

PDB entries

Related Diseases

recorded

Function

Serine protease inhibitor. Inhibits TMPRSS7 (PubMed:15853774). Is a primary inhibitor of tissue-type plasminogen activator (PLAT) and urokinase-type plasminogen activator (PLAU). As PLAT inhibitor, it is required for fibrinolysis down-regulation and is responsible for the controlled degradation of blood clots (PubMed:17912461, PubMed:8481516, PubMed:9207454, PubMed:21925150). As PLAU inhibitor, it is involved in the regulation of cell adhesion and spreading (PubMed:9175705). Acts as a regulator of cell migration, independently of its role as protease inhibitor (PubMed:15001579, PubMed:9168821). It is required for stimulation of keratinocyte migration during cutaneous injury repair (PubMed:18386027). It is involved in cellular and replicative senescence (PubMed:16862142). Plays a role in alveolar type 2 cells senescence in the lung (By similarity). Is involved in the regulation of cementogenic differentiation of periodontal ligament stem cells, and regulates odontoblast differentiation and dentin formation during odontogenesis (PubMed:25808697, PubMed:27046084)

Localization & Distribution

Tissue Specificity

Expressed in endothelial cells (PubMed:2430793, PubMed:3097076). Found in plasma, platelets, and hepatoma and fibrosarcoma cells

Related Diseases

Plasminogen activator inhibitor-1 deficiency

A hematologic disorder characterized by increased bleeding after trauma, injury, or surgery. Affected females have menorrhagia. The bleeding defect is due to increased fibrinolysis of fibrin blood clots due to deficiency of plasminogen activator inhibitor-1, which inhibits tissue and urinary activators of plasminogen.

Amino Acid Sequence

MQMSPALTCLVLGLALVFGEGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPY
GVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAI
FVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAV
DQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPD

FASTA format · 402 amino acids · mass 45.1 kDa

Experimental Structures

29 PDB entries

1A7C1B3K1C5G1DB21DVM1DVN1LJ51OC03CVM3EOX3PB13Q023Q033R4L3UT34AQH4G8O4G8R4IC05BRR5ZLZ6GWN6GWP6GWQ6I8S6ZRV7AQF7AQG9PAI

Post-Translational Modifications

•Inactivated by proteolytic attack of the urokinase-type (u-PA) and the tissue-type (TPA), cleaving the 369-Arg-|-Met-370 bond